PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010907545.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 358aa    MW: 39949.1 Da    PI: 8.5559
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010907545.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.14.2e-50221472128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +++++
  XP_010907545.1  22 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIKAEN 115
                     79***************************.89***************8778899***************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +glkktLvfy+g+apkg +t+W+m+eyrl
  XP_010907545.1 116 HRSIGLKKTLVFYTGKAPKGIRTSWIMNEYRL 147
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.5721168IPR003441NAC domain
SuperFamilySSF1019411.1E-5621168IPR003441NAC domain
PfamPF023653.8E-2523147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAIIAAMSAD DGKDAHEHDL VMPGFRFHPT EEELIEFYLR RKVEGKRFNV ELITFLDLYR  60
YDPWELPALA AIGEKEWFFY VPRDRKYRNG DRPNRVTTSG YWKATGADRM IKAENHRSIG  120
LKKTLVFYTG KAPKGIRTSW IMNEYRLPQS ETDRYQKAEI SLCRVYKRSG VDDHCQLPGT  180
LSTKASSSKA TGSDKKHGSS HQPPPSFQTF AGDCSSSVME KAPKIGGGTN TNMSAPVLQK  240
PAALYGSTAS VASLSSTTST EEDGTSLHHP KNTTALIPTC SVLTSATSSM VSPTIDELHS  300
LIGYNQSYMN QPNQFLPSQL QPQLLPLNTL PVSFPTISDK LWEWNALHEV GRDFTSFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-552316819165NO APICAL MERISTEM PROTEIN
1ut4_B2e-552316819165NO APICAL MERISTEM PROTEIN
1ut7_A2e-552316819165NO APICAL MERISTEM PROTEIN
1ut7_B2e-552316819165NO APICAL MERISTEM PROTEIN
3swm_A2e-552316822168NAC domain-containing protein 19
3swm_B2e-552316822168NAC domain-containing protein 19
3swm_C2e-552316822168NAC domain-containing protein 19
3swm_D2e-552316822168NAC domain-containing protein 19
3swp_A2e-552316822168NAC domain-containing protein 19
3swp_B2e-552316822168NAC domain-containing protein 19
3swp_C2e-552316822168NAC domain-containing protein 19
3swp_D2e-552316822168NAC domain-containing protein 19
4dul_A2e-552316819165NAC domain-containing protein 19
4dul_B2e-552316819165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010907545.10.0PREDICTED: transcription factor JUNGBRUNNEN 1
TrEMBLM0SGN50.0M0SGN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P21690_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-105NAC domain containing protein 35